RetrogeneDB ID: | retro_cjac_2070 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 22:21053052..21053286(+) | ||
| Located in intron of: | ENSCJAG00000032315 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MINOS1 | ||
| Ensembl ID: | ENSCJAG00000006709 | ||
| Aliases: | None | ||
| Description: | mitochondrial inner membrane organizing system 1 [Source:HGNC Symbol;Acc:32068] |
| Percent Identity: | 96.15 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHG |
| MSESEL.RKWDRCLADAV.KIGTGFGLGIVFSLTFFKRRMW.LAFGSGMGLGMAYSNCQHDFQAPYLLHG | |
| Retrocopy | MSESELRRKWDRCLADAVGKIGTGFGLGIVFSLTFFKRRMWLLAFGSGMGLGMAYSNCQHDFQAPYLLHG |
| Parental | KYVKEQEQ |
| KYVKEQEQ | |
| Retrocopy | KYVKEQEQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .04 RPM | 7 .37 RPM |
| SRP051959_heart | 0 .04 RPM | 15 .84 RPM |
| SRP051959_kidney | 0 .04 RPM | 8 .59 RPM |
| SRP051959_liver | 0 .00 RPM | 6 .58 RPM |
| SRP051959_lung | 0 .00 RPM | 4 .13 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 4 .02 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 10 .15 RPM |
| SRP051959_spleen | 0 .00 RPM | 4 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000006709 | 1 retrocopy |
retro_cjac_2070 ,
|
| Echinops telfairi | ENSETEG00000010942 | 5 retrocopies | |
| Homo sapiens | ENSG00000173436 | 3 retrocopies | |
| Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007347 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000005855 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007867 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001788 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000000269 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000002903 | 1 retrocopy |