RetrogeneDB ID: | retro_cpor_328 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_128:340452..340640(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUMO3 | ||
| Ensembl ID: | ENSCPOG00000025203 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.75 % |
| Parental protein coverage: | 57.27 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | DGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQ-LEMEDEDTIDVFQ |
| .GSV.Q.KI.R..PLSKLMKAYCER..LSMR.IR.RFDGQPINE.DT..Q..E...EDT.D.FQ | |
| Retrocopy | EGSVIQLKINRQAPLSKLMKAYCERHSLSMR*IRLRFDGQPINEIDTSVQ<MELDGEDTSDEFQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 27 .84 RPM |
| SRP017611_kidney | 0 .00 RPM | 28 .27 RPM |
| SRP017611_liver | 0 .00 RPM | 22 .11 RPM |
| SRP040447_lung | 0 .00 RPM | 54 .60 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 29 .68 RPM |