RetrogeneDB ID: | retro_dnov_2375 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_68815:8134..8517(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSDNOG00000015266 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ARF1 | ||
| Ensembl ID: | ENSDNOG00000010454 | ||
| Aliases: | None | ||
| Description: | ADP-ribosylation factor 1 [Source:HGNC Symbol;Acc:652] |
| Percent Identity: | 67.94 % |
| Parental protein coverage: | 71.82 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | NVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVL |
| .V...EYKN.S.TV.D.GGQ.KI.PLWRHYFQNT.GL.FVVDS.D.E.VNEA..EL.R.LAEDELR..V. | |
| Retrocopy | SVWKLEYKN-SLTVRDMGGQYKIQPLWRHYFQNTPGLVFVVDSSDQECVNEAHRELLRVLAEDELRGSV- |
| Parental | LVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLY-EGLDWLSNQLRNQK |
| .VF.NKQDLP.A.NAA.....LGLH.L.HRNWY..A.CATS.D.LY..GLDWLS..LRNQK | |
| Retrocopy | TVFPNKQDLPSALNAADVAGELGLHPLCHRNWYTEAMCATSRDRLY<QGLDWLSIKLRNQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .19 RPM | 138 .27 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 67 .63 RPM |
| SRP012922_heart | 0 .00 RPM | 28 .77 RPM |
| SRP012922_kidney | 0 .00 RPM | 52 .57 RPM |
| SRP012922_liver | 0 .00 RPM | 38 .24 RPM |
| SRP012922_lung | 0 .00 RPM | 83 .85 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 34 .96 RPM |
| SRP012922_spleen | 0 .00 RPM | 85 .50 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anas platyrhynchos | ENSAPLG00000004509 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016671 | 10 retrocopies | |
| Ciona savignyi | ENSCSAVG00000007011 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010454 | 3 retrocopies |
retro_dnov_2375 , retro_dnov_2459, retro_dnov_26,
|
| Dasypus novemcinctus | ENSDNOG00000013387 | 5 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000004638 | 4 retrocopies | |
| Gallus gallus | ENSGALG00000005393 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000019009 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007020 | 6 retrocopies | |
| Macaca mulatta | ENSMMUG00000002792 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000023645 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000014202 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000002066 | 2 retrocopies | |
| Tetraodon nigroviridis | ENSTNIG00000011685 | 1 retrocopy |