RetrogeneDB ID: | retro_dnov_2470 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_78062:75..294(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBL5 | ||
| Ensembl ID: | ENSDNOG00000006384 | ||
| Aliases: | None | ||
| Description: | ubiquitin-like 5 [Source:HGNC Symbol;Acc:13736] |
| Percent Identity: | 68.49 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVCLGDYEIHDGMNLEL |
| ..E.VCNDR.G..V.VKC..DD.I..LKK.IAA.TGTRWNKI..KKW...FKDHVCLGDY.IHDGMN.EL | |
| Retrocopy | VLEAVCNDRPGTEVGVKCSADDAIRALKKRIAA*TGTRWNKIAPKKWHAVFKDHVCLGDYKIHDGMNWEL |
| Parental | YYQ |
| ..Q | |
| Retrocopy | DHQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 202 .05 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 161 .80 RPM |
| SRP012922_heart | 0 .00 RPM | 239 .46 RPM |
| SRP012922_kidney | 0 .00 RPM | 312 .67 RPM |
| SRP012922_liver | 0 .00 RPM | 86 .07 RPM |
| SRP012922_lung | 0 .00 RPM | 220 .84 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 124 .97 RPM |
| SRP012922_spleen | 0 .00 RPM | 213 .93 RPM |