RetrogeneDB ID: | retro_gacu_18 | ||
Retrocopylocation | Organism: | Stickleback (Gasterosteus aculeatus) | |
Coordinates: | groupVII:11969110..11969264(+) | ||
Located in intron of: | ENSGACG00000020129 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSGACG00000006261 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 55.77 % |
Parental protein coverage: | 51. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | VVPRVLKSRMGARAFSYQDPLLSSQLPLSV-RGADSVSNWHSCVSSPLISTS |
..PRVLKSR.GAR.FS.Q..LLS.QL.LSV..GAD.VS.........L.S.S | |
Retrocopy | LLPRVLKSRIGARTFSHQSSLLSDQLLLSV>GGADTVSSFKTRLMVFLLSGS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Gasterosteus aculeatus | ENSGACG00000006261 | 1 retrocopy |
retro_gacu_18 ,
|