RetrogeneDB ID: | retro_lafr_1028 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_6:38497701..38497929(-) | ||
Located in intron of: | ENSLAFG00000010867 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PCBD1 | ||
Ensembl ID: | ENSLAFG00000001397 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 81.58 % |
Parental protein coverage: | 73.08 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | EGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQ |
EGRD.IFKQFH..DFN.AFGFMTRV.LQAEK.DHHPEWFN.Y.KVHI.LST.E.AGLSE.DINLASFIEQ | |
Retrocopy | EGRDTIFKQFHL*DFNKAFGFMTRVVLQAEKPDHHPEWFNMYSKVHIILSTCERAGLSEQDINLASFIEQ |
Parental | VAVSMT |
.A.SMT | |
Retrocopy | LAASMT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000011866 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012703 | 1 retrocopy | |
Felis catus | ENSFCAG00000001235 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000001397 | 1 retrocopy |
retro_lafr_1028 ,
|
Myotis lucifugus | ENSMLUG00000016074 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000007201 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000010275 | 1 retrocopy | |
Takifugu rubripes | ENSTRUG00000017869 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000005775 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000004496 | 1 retrocopy |