RetrogeneDB ID: | retro_mmul_454 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:201099673..201100114(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GM2A | ||
| Ensembl ID: | ENSMMUG00000022869 | ||
| Aliases: | None | ||
| Description: | GM2 ganglioside activator [Source:HGNC Symbol;Acc:4367] |
| Percent Identity: | 64.67 % |
| Parental protein coverage: | 75.65 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MQSLMQAPVLIALGLLFA---APAQAHLKKPSKLGSFSWDNCDEGKDPAVIRSLTLEPDPIL-IPGNVTV |
| .QSLM.AP.LI.LGLL.A...APA..HL.......SF.WD..D.GKDP.VIRSL.LE.D.....PGNV.V | |
| Retrocopy | VQSLMEAPLLIVLGLLLAGLEAPAHVHL---NQISSFPWDS*DKGKDPVVIRSLSLEADQXXXVPGNVIV |
| Parental | GVVGSTSVPLSSPLKVELVLEKEVAGLWIKIPCTDYIGSCTFEDFCDVLDMLIPTGEPCPEPLRTYGLPC |
| ...G.TSVPL..PLKVEL...KEVAG.W.KI.C...IGSC..E.FCDVLD.LIP.GEPCPEPL.TYGL.C | |
| Retrocopy | SAEGKTSVPLKYPLKVELTVGKEVAGFWVKISCMEQIGSCAYENFCDVLDTLIPPGEPCPEPLHTYGLLC |
| Parental | HCPFKEGTYS |
| .CPFKEGTYS | |
| Retrocopy | YCPFKEGTYS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 4 .15 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .13 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .81 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .77 RPM |
| SRP007412_kidney | 0 .00 RPM | 6 .46 RPM |
| SRP007412_liver | 0 .12 RPM | 9 .26 RPM |
| SRP007412_testis | 0 .08 RPM | 4 .00 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_264 |
| Gorilla gorilla | retro_ggor_313 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000020587 | 1 retrocopy | |
| Homo sapiens | ENSG00000196743 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015302 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000010421 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000000690 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003215 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000022869 | 1 retrocopy |
retro_mmul_454 ,
|
| Nomascus leucogenys | ENSNLEG00000010966 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000015837 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000006171 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015962 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017431 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000028500 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000503 | 1 retrocopy |