RetrogeneDB ID: | retro_mmul_471 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:24655881..24656216(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.872 | ||
| Ensembl ID: | ENSMMUG00000022575 | ||
| Aliases: | None | ||
| Description: | M-phase phosphoprotein 6 [Source:RefSeq peptide;Acc:NP_001180532] |
| Percent Identity: | 67.83 % |
| Parental protein coverage: | 70.62 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEK-ESFIIEEQSFLLCED |
| MA.E.KTK.SKNLL.MKFMQRGLDS.TKK.LEEEE.K.IS.EHWY.DL.EL......F..EE...LLCED | |
| Retrocopy | MAPEHKTKFSKNLLHMKFMQRGLDSKTKK*LEEEENK-IS*EHWYSDLLELNKS>KNFLTEEEHLLLCED |
| Parental | LLYGR-MSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEE |
| ..YGR.MSF..F.PEVEKLMLQMN.K.KA...ED.TVE..VS.EE | |
| Retrocopy | HFYGR>MSFIRFTPEVEKLMLQMNTKNKA-DIEDGTVEFYVSEEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 8 .52 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .27 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 7 .75 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .36 RPM |
| SRP007412_kidney | 0 .12 RPM | 4 .81 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .39 RPM |
| SRP007412_testis | 0 .04 RPM | 3 .69 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_353 |
| Pan troglodytes | retro_ptro_277 |
| Pongo abelii | retro_pabe_348 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000127 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016498 | 5 retrocopies | |
| Dipodomys ordii | ENSDORG00000011060 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000010276 | 6 retrocopies | |
| Homo sapiens | ENSG00000135698 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001405 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000000580 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000000268 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000022575 | 2 retrocopies |
retro_mmul_1786, retro_mmul_471 ,
|
| Mus musculus | ENSMUSG00000031843 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010725 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000024341 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000012532 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000007592 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008398 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000050087 | 6 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013110 | 8 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001928 | 2 retrocopies |