RetrogeneDB ID: | retro_mputfur_1488 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL897165.1:1125990..1126220(-) | ||
| Located in intron of: | ENSMPUG00000001974 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SSBP1 | ||
| Ensembl ID: | ENSMPUG00000003257 | ||
| Aliases: | None | ||
| Description: | single-stranded DNA binding protein 1, mitochondrial [Source:HGNC Symbol;Acc:11317] |
| Percent Identity: | 71.25 % |
| Parental protein coverage: | 52.03 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
| Parental | EAYQMGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYV-EGKVDYGEYTD-KNNVRRQATTIIADNII |
| ..YQMGDVS.KTT.HRISVF.PGLRDVA.Q.VKKGS.IYV.EGK.D.GEYT..KNNVRR....IIADNI. | |
| Retrocopy | KTYQMGDVSRKTT*HRISVF*PGLRDVAHQ*VKKGSWIYV<EGKADCGEYTS>KNNVRRKEKRIIADNIV |
| Parental | FL-SDQTKEK |
| FL..D.TK.. | |
| Retrocopy | FL<GDHTKDQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |