RetrogeneDB ID: | retro_mputfur_919 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896971.1:6526878..6527252(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DCUN1D1 | ||
| Ensembl ID: | ENSMPUG00000002369 | ||
| Aliases: | None | ||
| Description: | DCN1, defective in cullin neddylation 1, domain containing 1 [Source:HGNC Symbol;Acc:18184] |
| Percent Identity: | 67.46 % |
| Parental protein coverage: | 50.41 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | LKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLN-GRFKFLDLWNKFLLEHHK |
| L.AQIPKME.E.KEPG..KDFYQFTFNFA.....KGLDL.MAIAY.NLVL..GRFKFLDLWN..L.E.HK | |
| Retrocopy | LRAQIPKMEKESKEPG*LKDFYQFTFNFAMILRWKGLDLKMAIAYLNLVLK<GRFKFLDLWNNSLVEYHK |
| Parental | RSIPKDTWNLLLDFSTMIADDMSN--YDEEGAWPVLIDDFVEFARPQIAGTKSTTV |
| .SI.KD.WNL.L..STM.A.D........E.AW.VL.D.FVEFA.PQIAGT..TTV | |
| Retrocopy | *SI*KDIWNLPLTISTMNAEDNLSIMMKKERAWHVLTDNFVEFACPQIAGTRCTTV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013358 | 14 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005148 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000022086 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000019073 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000000166 | 1 retrocopy | |
| Homo sapiens | ENSG00000043093 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000010767 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010552 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000002369 | 1 retrocopy |
retro_mputfur_919 ,
|
| Mus musculus | ENSMUSG00000027708 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005983 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000658 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015661 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012276 | 1 retrocopy |