RetrogeneDB ID: | retro_pabe_381 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 1:45828174..45828407(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPF | ||
| Ensembl ID: | ENSPPYG00000004847 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide F [Source:HGNC Symbol;Acc:11162] |
| Percent Identity: | 85.0 % |
| Parental protein coverage: | 91.86 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MSLPLNPKPFLNGLTGKPVMVKLKW-GMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNV |
| MSLPLN.K.FL.GLTG.PVMVKLKW.GMEYKGYLVSVDGYMNMQLA.TE..I..AL.GHLGEVLIRCNNV | |
| Retrocopy | MSLPLNLKYFLSGLTGEPVMVKLKW<GMEYKGYLVSVDGYMNMQLADTE-FINEALPGHLGEVLIRCNNV |
| Parental | LYIRGVEEEE |
| L.IRGVEEEE | |
| Retrocopy | LFIRGVEEEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .75 RPM |
| SRP007412_cerebellum | 0 .24 RPM | 9 .73 RPM |
| SRP007412_heart | 0 .00 RPM | 7 .89 RPM |
| SRP007412_kidney | 0 .00 RPM | 11 .34 RPM |
| SRP007412_liver | 0 .00 RPM | 9 .06 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000016271 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019817 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
| Homo sapiens | ENSG00000139343 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001127 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000009302 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007176 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000020018 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005835 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000004847 | 2 retrocopies |
retro_pabe_381 , retro_pabe_489,
|
| Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000009036 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005556 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000000895 | 1 retrocopy |