RetrogeneDB ID: | retro_shar_232 | ||
Retrocopy location | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
| Coordinates: | GL834722.1:684611..684788(-) | ||
| Located in intron of: | ENSSHAG00000010370 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUMO3 | ||
| Ensembl ID: | ENSSHAG00000002220 | ||
| Aliases: | None | ||
| Description: | small ubiquitin-like modifier 3 [Source:HGNC Symbol;Acc:11124] |
| Percent Identity: | 79.66 % |
| Parental protein coverage: | 63.44 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KRHTPLNKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG |
| .RH.PL.KLMK.YCE..GLS.RQ.RFRFDGQPINETDT..Q.EMEDEDTIDVFQQQ.GG | |
| Retrocopy | ERHRPLSKLMKVYCEQEGLSIRQMRFRFDGQPINETDTLEQKEMEDEDTIDVFQQQIGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |