RetrogeneDB ID: | retro_sscr_105 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 1:41526545..41526921(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C12orf45 | ||
| Ensembl ID: | ENSSSCG00000027792 | ||
| Aliases: | None | ||
| Description: | chromosome 12 open reading frame 45 [Source:HGNC Symbol;Acc:28628] |
| Percent Identity: | 61.9 % |
| Parental protein coverage: | 68.31 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MEVQSESQSGPTCSSSSQNHSGVSVSKELLTAGSGDQGGIWDKLLINSKPNSRKNSTLQTVRIERSPLLD |
| MEVQ.E.Q.GPT.SSSS...SGV.VSKELL.A.S..QGG.WD.LLINSK..SR.NSTL.T...ERSP.LD | |
| Retrocopy | MEVQPEPQFGPTSSSSSGDCSGVLVSKELLMAESSGQGGKWDRLLINSKTTSRRNSTL*TFPMERSPFLD |
| Parental | RVQTFLPQMAQANEQLRKEMAAA-PPGCFNIENIDETLGKVIQMDVALFEMNPSDS |
| ..QTFL.Q............AA..PPG.FNIEN.DE.LGK...MDVA.FEMN..DS | |
| Retrocopy | QGQTFLSQIVRHEQLRKEMAAAP>PPGRFNIENTDEILGKAK*MDVASFEMNLPDS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 1 .86 RPM |
| SRP014902_testis | 0 .00 RPM | 7 .07 RPM |
| SRP018288_heart | 0 .00 RPM | 4 .56 RPM |
| SRP018288_kidney | 0 .00 RPM | 5 .81 RPM |
| SRP018288_liver | 0 .00 RPM | 10 .87 RPM |
| SRP018288_lung | 0 .00 RPM | 3 .46 RPM |
| SRP018856_adipose | 0 .00 RPM | 11 .60 RPM |
| SRP035408_brain | 0 .00 RPM | 4 .80 RPM |
| SRP035408_liver | 0 .00 RPM | 8 .22 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000014728 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017235 | 1 retrocopy | |
| Homo sapiens | ENSG00000151131 | 1 retrocopy | |
| Gallus gallus | ENSGALG00000012694 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027272 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017133 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006584 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004897 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005381 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000027792 | 2 retrocopies |
retro_sscr_105 , retro_sscr_153,
|
| Tursiops truncatus | ENSTTRG00000005714 | 1 retrocopy |