RetrogeneDB ID: | retro_sscr_809 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 5:17475202..17475424(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000014569 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.89 % |
| Parental protein coverage: | 51.35 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKLWT |
| L.GH..H.H..I......P......GG..HHR..FDKYHPG..GKVG.RHY.LK.NQSF.PTV..DKLWT | |
| Retrocopy | LLGHMNHTHSLISTGS--PRSPRDLGGTQHHRLYFDKYHPGVIGKVGVRHYCLKNNQSFRPTVSFDKLWT |
| Parental | LVSEQT |
| .V.EQT | |
| Retrocopy | VVTEQT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 230 .29 RPM |
| SRP014902_testis | 0 .00 RPM | 256 .44 RPM |
| SRP018288_heart | 0 .00 RPM | 208 .27 RPM |
| SRP018288_kidney | 0 .00 RPM | 214 .84 RPM |
| SRP018288_liver | 0 .00 RPM | 448 .23 RPM |
| SRP018288_lung | 0 .00 RPM | 205 .38 RPM |
| SRP018856_adipose | 0 .00 RPM | 219 .29 RPM |
| SRP035408_brain | 0 .00 RPM | 114 .27 RPM |
| SRP035408_liver | 0 .00 RPM | 176 .75 RPM |