RetrogeneDB ID: | retro_tsyr_857 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_219648:2183..2398(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HMGN2 | ||
| Ensembl ID: | ENSTSYG00000011519 | ||
| Aliases: | None | ||
| Description: | high mobility group nucleosomal binding domain 2 [Source:HGNC Symbol;Acc:4986] |
| Percent Identity: | 91.78 % |
| Parental protein coverage: | 84.71 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | DEPQRRSAR-LSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAG |
| .EPQRRSAR..SAK.APPKPEPKPKKAPAKKGEKVPKGKKGKADAG.EGNNP.ENGDAKTDQAQKAEGAG | |
| Retrocopy | NEPQRRSAR<VSAKSAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGMEGNNPEENGDAKTDQAQKAEGAG |
| Parental | DAK |
| DAK | |
| Retrocopy | DAK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |