miRNEST 2.0: an integrative microRNA resource miRNEST 2.0, an integrative microRNA resource :: Browse :: Contigs




EST name EST sequence
gi|238169555|gb|GR042123.1|GR042123 GGGCTTGGTTGGCGCCGGACCAGGACATTCGTTGTCTGGCCCGGGGCAATCAGGATTGCTTCGGTCGAGAAGGGCTTTGT
GTAGACCGCGTCGACTTCCACTACGGTTAGCGTGTGGTTTGCGATGGCGAAGAAGAGCTCGTCGTTGAGTGCCGCGTTGA
TGATCCGCAGGAGGTAGGTTTTGCCTTGCTCGACTTCTATTGCGTAAGTGTGTTTTTCGGAACACGGGTAGAGTGGGCCC
GGCTTGCCGTTGATAGTATGCGCATCGGACATCTTCGGAGGCAATCCGAGCTTATTTCCTTGTTTAACAATCTCTTCAAC
ATCATCATTCCACCACTCCCCTAGGACTAAATTAAACTCGAAAGCAGGCTGAGGAAAAGGATAAGGAACCCCAATTTTGG
GCATAATTACAATAGCACCATAAACAGTAGCTCTTAGCCAAAATATATGTGCATGCCACCATAGTGTTCCTCGTTGACCG
GTTACATTATAATCGTACGTGTAACTTTGACCGGTCTGAACCGGACATTGTGTTATATAAGCCGGTCCATCTGCCCACCC
GTTTCGGTATTGCTTCATTCCATGCCAGTGAATGGACATGTTATATTGTGCATGGTTAGTGACGTTAATAAGAAGTCGAT
CTCCTTCTCTAACGTAGATCGTTGGCCCTGGGAAACATCCCGGTTTACCGTTACAATTGGCTTCGAATGGCACAACCTGC
TCACATTCTTCACTTGAATGTCGAACTGGTATTTTT




Most similar to sp|Q8VZA1|LAC11_ARATH

>BLASTX 2.2.20 [Feb-08-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
>sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11
           PE=2 SV=1
          Length = 557

 Score =  406 bits (1044), Expect = e-113
 Identities = 186/244 (76%), Positives = 204/244 (83%), Gaps = 5/244 (2%)
 Frame = -2

Query: 719 QVVPFEANCNGKP-----GCFPGPTIYVREGDRLLINVTNHAQYNMSIHWHGMKQYRNGW 555
           QV      CN KP     G FPGPT+Y REGDR++INVTNH QYNMSIHWHG+KQYRNGW
Sbjct: 33  QVKNISRICNAKPIVTVNGMFPGPTVYAREGDRVIINVTNHVQYNMSIHWHGLKQYRNGW 92

Query: 554 ADGPAYITQCPVQTGQSYTYDYNVTGQRGTLWWHAHIFWLRATVYGAIVIMPKIGVPYPF 375
           ADGPAYITQCP+QTGQSY YD+NVTGQRGTLWWHAHI WLRATVYGAIVI+P  G PYPF
Sbjct: 93  ADGPAYITQCPIQTGQSYLYDFNVTGQRGTLWWHAHILWLRATVYGAIVILPAPGKPYPF 152

Query: 374 PQPAFEFNLVLGEWWNDDVEEIVKQGNKLGLPPKMSDAHTINGKPGPLYPCSEKHTYAIE 195
           PQP  E N++LGEWWN DVE  V Q N+LG PP MSDAHTINGKPGPL+PCSEKHT+ IE
Sbjct: 153 PQPYQESNIILGEWWNKDVETAVNQANQLGAPPPMSDAHTINGKPGPLFPCSEKHTFVIE 212

Query: 194 VEQGKTYLLRIINAALNDELFFAIANHTLTVVEVDAVYTKPFSTEAILIAPGQTTNVLVR 15
            E GKTYLLRIINAALNDELFF IA H +TVVE+DAVYTKPF+T+AIL+ PGQTTNVLV+
Sbjct: 213 AEAGKTYLLRIINAALNDELFFGIAGHNMTVVEIDAVYTKPFTTKAILLGPGQTTNVLVK 272

Query: 14  RQPS 3
              S
Sbjct: 273 TDRS 276