miRNEST 2.0: an integrative microRNA resource miRNEST 2.0, an integrative microRNA resource :: Browse :: Contigs




EST name EST sequence
gi|39835961|gb|CK278983.1|CK278983 CACCGTTGGACTTATCCTTCACTCTGCTCTGTTGGTGCCGTACTTCTCTTGGAAATATAGTCATCGTCGCCACCACTCCA
ACACTGGCTCCCTCGAGCGTGATGAGGTCTTTGTGCCCAAGCCAAAATCTCAGCTCGGATGGTATTCCAAGTACTTGAAC
AATCCACCAGGCAGGGTCCTCTCACTTACAATCACCCTCACTCTTGGCTGGCCGTTGTACTTGGCCTTCAATGTATCTGG
CAGACCATACGACCGATTTGCATGTCACTATGACCCTTACGGCCCAATCTACAACAACCGTGAGAGGCTACAGATCTTCG
TTTCTGATGCTGGAGTTCTCGGAGTTTGTTATCTGCTATACCGTATTGCCTTAGTGAAAGGTCTAGCTTGGCTAGTGTGC
ATCTACGGTGTACCCCTCCTCGTCGTGAACGGCTTCCTTGTCTTGATCACCTACTTGCAGCACACTCACCCATCATTGCC
ACACTACGATTCAACCGAGTGGGATTGGCTTAGGGGAGCTTTGGCAACCTGTGACAGAGACTATGGGGTTCTAAACAAGG
TCTTCCACAACATCACCGACACTCACGTGGTGCACCATCTGTTCTCAACCATGCCACACTACAACGCGATGGAGGCAACC
AAAGCAGTCAAGCCACTACTCGGAGACTACTACCAATTCGATGGAACCCCGATTTTCAAGGCAATGTGGAGGGAAGCTAA
AGAGTGTCTCTACGTCGAGAAAGACGAATCATCTCAAGGCAAAGGTGTCTTCTGGTACAAAAACAAGCTCTGAAATACTA
GAACAGAAACTCAGCTTGCTTTGAATTGGTCTTTTGGTAATGTTTGGTCAGTGTCTTGAGTAAGTATTTTGGATTTAAGT
TATTTAGCTAATGTGTTGTCTTTGTTAGTAAGGGGAGGTTTATGTTTGATGAAATTTTTTGATAATAA




Most similar to sp|P48631|FD6E2_SOYBN

>BLASTX 2.2.20 [Feb-08-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
>sp|P48631|FD6E2_SOYBN Omega-6 fatty acid desaturase, endoplasmic
           reticulum isozyme 2 OS=Glycine max GN=FAD2-2 PE=2 SV=1
          Length = 383

 Score =  486 bits (1252), Expect = e-137
 Identities = 218/262 (83%), Positives = 244/262 (93%)
 Frame = +2

Query: 5   VGLILHSALLVPYFSWKYSHRRHHSNTGSLERDEVFVPKPKSQLGWYSKYLNNPPGRVLS 184
           VGLILHSALLVPYFSWKYSHRRHHSNTGSLERDEVFVPK KS + WYSKYLNNPPGRVL+
Sbjct: 122 VGLILHSALLVPYFSWKYSHRRHHSNTGSLERDEVFVPKQKSCIKWYSKYLNNPPGRVLT 181

Query: 185 LTITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNNRERLQIFVSDAGVLGVCYLLYR 364
           L +TLTLGWPLYLA NVSGRPYDRFACHYDPYGPIY++RERLQI++SDAGVL V Y L+R
Sbjct: 182 LAVTLTLGWPLYLALNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDAGVLAVVYGLFR 241

Query: 365 IALVKGLAWLVCIYGVPLLVVNGFLVLITYLQHTHPSLPHYDSTEWDWLRGALATCDRDY 544
           +A+ KGLAW+VC+YGVPLLVVNGFLVLIT+LQHTHP+LPHY S+EWDWLRGALAT DRDY
Sbjct: 242 LAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYTSSEWDWLRGALATVDRDY 301

Query: 545 GVLNKVFHNITDTHVVHHLFSTMPHYNAMEATKAVKPLLGDYYQFDGTPIFKAMWREAKE 724
           G+LNKVFHNITDTHV HHLFSTMPHY+AMEATKA+KP+LG+YY+FD TP  KAMWREA+E
Sbjct: 302 GILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYRFDETPFVKAMWREARE 361

Query: 725 CLYVEKDESSQGKGVFWYKNKL 790
           C+YVE D+S++ KGVFWY NKL
Sbjct: 362 CIYVEPDQSTESKGVFWYNNKL 383