miRNEST 2.0: an integrative microRNA resource miRNEST 2.0, an integrative microRNA resource :: Browse :: Contigs




EST name EST sequence
gi|89969829|gb|DY756238.1|DY756238 CCGCGCGGCTGGAGGTGTGATGATCCGAGCTTACGGGTGGGGGTGGAGGCGGCTCCTGCGGTCGAGATGGACTTGAGACT
CGCCGGCCGCACGCCAGTGAGGGCCCGTGTGGGTGCTGGTCCTCTGCTGCCTCCTGCTGACCTTCGGGGCTGTCAGATGT
GACGACGAAGTTGATGTGGATGGTACAGTAGAAGAGGATCTGGGTAAAAGTAGAGAAGGCTCAAGGACGGATGATGAAGT
AGTACAGAGAGAGGAAGAAGCTATTCAGTTGGATGGATTAAATGCATCGCAAATAAGAGAACTTAGAGAGAAGTCGGAAA
AGTTTGCCTTTCAAGCTGAAGTTAACAGAATGATGAAACTTATCATCAATTCATTGTATAAAAATAAAGAGATTTTCCTG
AGAGAACTGATTTCAAATGCTTCCGACGCTTTAGATAAGATACGGCTAATATCACTGACTGATGAAAATGCTCTTTCTGG
AAATGAGGAACTAACAGTTAAAATTAAGTGTGATAAGGAGAAGAACCTGCTGCATGTCACAGACACCGGTGTAGGAATGA
CCAGAGAATAGTTGGTTAAGAACCTTGGTACCATAGCCAATTCTGGACAAGCGAGTTTTTAAACAGATGACGGAGTCTCA
NGAAGATGCCCAGTCAACTTCCGAATTGATTGCCAGTATGGTGTTGTTTTCTATCCGCCTT




Most similar to sp|Q5R6F7|ENPL_PONAB

>BLASTX 2.2.20 [Feb-08-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
>sp|Q5R6F7|ENPL_PONAB Endoplasmin OS=Pongo abelii GN=HSP90B1 PE=2
           SV=1
          Length = 804

 Score =  264 bits (674), Expect(2) = 2e-71
 Identities = 141/171 (82%), Positives = 144/171 (84%)
 Frame = +2

Query: 107 VWXXXXXXXXXTFGAVRCXXXXXXXXXXXXXLGKSREGSRTDDEVVQREEEAIQLDGLNA 286
           +W         TFG+VR              LGKSREGSRTDDEVVQREEEAIQLDGLNA
Sbjct: 4   LWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNA 63

Query: 287 SQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDE 466
           SQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDE
Sbjct: 64  SQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDE 123

Query: 467 NALSGNEELTVKIKCDKEKNLLHVTDTGVGMTRE*LVKNLGTIANSGQASF 619
           NALSGNEELTVKIKCDKEKNLLHVTDTGVGMTRE LVKNLGTIA SG + F
Sbjct: 124 NALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEF 174



 Score = 26.9 bits (58), Expect(2) = 2e-71
 Identities = 12/16 (75%), Positives = 14/16 (87%)
 Frame = +3

Query: 624 QMTESXEDAQSTSELI 671
           +MTE+ ED QSTSELI
Sbjct: 177 KMTEAQEDGQSTSELI 192


>sp|Q4R520|ENPL_MACFA Endoplasmin OS=Macaca fascicularis GN=HSP90B1
           PE=2 SV=1
          Length = 804

 Score =  264 bits (675), Expect = 4e-70
 Identities = 149/202 (73%), Positives = 155/202 (76%), Gaps = 6/202 (2%)
 Frame = +2

Query: 107 VWXXXXXXXXXTFGAVRCXXXXXXXXXXXXXLGKSREGSRTDDEVVQREEEAIQLDGLNA 286
           +W         TFG+VR              LGKSREGSRTDDEVVQREEEAIQLDGLNA
Sbjct: 4   LWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNA 63

Query: 287 SQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDE 466
           SQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDE
Sbjct: 64  SQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDE 123

Query: 467 NALSGNEELTVKIKCDKEKNLLHVTDTGVGMTRE*LVKNLGTIANSGQASF*T------D 628
           NALSGNEELTVKIKCDKEKNLLHVTDTGVGMTRE LVKNLGTIA SG + F        +
Sbjct: 124 NALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQE 183

Query: 629 DGVSXRCPVNFRIDCQYGVVFY 694
           DG S        +  Q+GV FY
Sbjct: 184 DGQS-----TSELIGQFGVGFY 200