RetrogeneDB ID: | retro_cpor_147 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_0:14513872..14514091(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HMGN3 | ||
Ensembl ID: | ENSCPOG00000012407 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 87.67 % |
Parental protein coverage: | 73.74 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KKQSSENTEGKEGSKVTKQEPTRRSARLSTKPAPPKPEPKPRKTAIKKEPGTKINRGAKGKKEEKQEAGK |
K..SSENTEGK.G.KVTKQEPTRRS.RLS.KPAP.KPEPKPRKTA.K.EPGTKINRGAKGKKEEKQEAGK | |
Retrocopy | KRKSSENTEGKDGPKVTKQEPTRRSSRLSMKPAP*KPEPKPRKTATKEEPGTKINRGAKGKKEEKQEAGK |
Parental | EGT |
EGT | |
Retrocopy | EGT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .23 RPM | 17 .77 RPM |
SRP017611_kidney | 0 .21 RPM | 18 .22 RPM |
SRP017611_liver | 0 .04 RPM | 8 .79 RPM |
SRP040447_lung | 0 .08 RPM | 22 .35 RPM |
SRP040447_skeletal_muscle | 0 .03 RPM | 8 .08 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000007015 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012407 | 2 retrocopies |
retro_cpor_1399, retro_cpor_147 ,
|
Felis catus | ENSFCAG00000028793 | 1 retrocopy | |
Homo sapiens | ENSG00000118418 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006910 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000004351 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000012377 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000016487 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000009611 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000018366 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000014353 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015468 | 3 retrocopies | |
Tarsius syrichta | ENSTSYG00000005238 | 3 retrocopies |