RetrogeneDB ID: | retro_ecab_235 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 10:26985822..26986260(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFB5 | ||
Ensembl ID: | ENSECAG00000000682 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa [Source:HGNC Symbol;Acc:7700] |
Percent Identity: | 62.25 % |
Parental protein coverage: | 78.72 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 3 |
Parental | AMSLLQRASVAAA-SLCGRRLGPRHAFGGFLTRGFPKTVAPVRHSGGHGKRLFIIKPSGFYDRRFLNLMR |
AMSL.Q.A.V..A.S..G..LG....F....TR...KTVAPV.HSGGH.K.LFI...SGF.D..F.NL.. | |
Retrocopy | AMSLSQWALVTVA<SQSGHHLGTQLRFRDVFTRSLLKTVAPV*HSGGHRKGLFILS-SGFCDSVFWNLVK |
Parental | FYILLTGIPVA-IGITLINVFIGEAELAEIPEGYIPEHWEYFKHPISRWIARTFFDSPEKNYEKTLAILQ |
.YILLTGI.VA.IGITL.NVFIGEAELAEIP.GY.P.HWEYF.HP.SR....TFFD.P.KN.EKT..IL. | |
Retrocopy | LYILLTGIAVA<IGITLVNVFIGEAELAEIPKGYVPGHWEYFNHPLSR*TSCTFFDVPGKNHEKTMPIL* |
Parental | I-EAEKADLRL |
..EA.KA.L.L | |
Retrocopy | M<EAKKAELQL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 8 .21 RPM |
SRP021940_cerebellum | 0 .05 RPM | 40 .51 RPM |
SRP021940_embryo | 0 .08 RPM | 21 .61 RPM |
SRP021940_placental_villous | 0 .00 RPM | 28 .96 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 12 .38 RPM |
SRP021940_testis | 0 .00 RPM | 26 .02 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000002684 | 1 retrocopy | |
Equus caballus | ENSECAG00000000682 | 1 retrocopy |
retro_ecab_235 ,
|
Echinops telfairi | ENSETEG00000019363 | 1 retrocopy | |
Homo sapiens | ENSG00000136521 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000014166 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000000999 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000009746 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000021300 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005842 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000014493 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000015649 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000004286 | 1 retrocopy | |
Sorex araneus | ENSSARG00000006918 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000011764 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000010557 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000008910 | 3 retrocopies |