RetrogeneDB ID: | retro_etel_195 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | GeneScaffold_3381:13751..13968(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFC1 | ||
Ensembl ID: | ENSETEG00000004800 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa [Source:HGNC Symbol;Acc:7705] |
Percent Identity: | 53.42 % |
Parental protein coverage: | 95.95 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | PAVLRPFSRLLTPARLPSSPSARSMFYLQEPTNSNPHGLGVGLTLGITVFPGL-IKQHN-EDVLEYKRRN |
P..L..FS.LLTPA.LP...S.RS.FY.QEPTNS.P..L.VGLT.G.....GL....H..E.V.E.K.R. | |
Retrocopy | P*ILHSFSQLLTPAWLPHNLSGRSKFYIQEPTNSKPEWLEVGLTMGTGLPVGL>VITHHNEEV*E*KIRK |
Parental | GLE |
.LE | |
Retrocopy | ELE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011040 | 2 retrocopies | |
Bos taurus | ENSBTAG00000039582 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000015639 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000004800 | 11 retrocopies |
retro_etel_1014, retro_etel_1025, retro_etel_135, retro_etel_1735, retro_etel_195 , retro_etel_1966, retro_etel_214, retro_etel_670, retro_etel_700, retro_etel_701, retro_etel_87,
|
Felis catus | ENSFCAG00000008548 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000010459 | 5 retrocopies | |
Microcebus murinus | ENSMICG00000006836 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000009082 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000023590 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000001107 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000007703 | 1 retrocopy |