RetrogeneDB ID: | retro_etel_322 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | GeneScaffold_5335:81836..82019(+) | ||
Located in intron of: | ENSETEG00000014334 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPL33 | ||
Ensembl ID: | ENSETEG00000003239 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein L33 [Source:HGNC Symbol;Acc:14487] |
Percent Identity: | 79.37 % |
Parental protein coverage: | 93.85 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MFLTAVSFARSKSK-NILVKMLSQAGTGYTFNTKRSRLREKLTLLRYDPVVQ-KKVLFVEQKK |
MFLTAVS.A...SK..ILVKMLSQAGTGY.FNT.RSRLREKLTLLRYDP....KKVLFVEQK. | |
Retrocopy | MFLTAVSSAKGISK<TILVKMLSQAGTGYVFNTERSRLREKLTLLRYDPIGH>KKVLFVEQKE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000015881 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000003239 | 2 retrocopies |
retro_etel_2106, retro_etel_322 ,
|
Mus musculus | ENSMUSG00000029142 | 2 retrocopies |