RetrogeneDB ID: | retro_etel_961 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_191646:2273..2484(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SHFM1 | ||
Ensembl ID: | ENSETEG00000019778 | ||
Aliases: | None | ||
Description: | split hand/foot malformation (ectrodactyly) type 1 [Source:HGNC Symbol;Acc:10845] |
Percent Identity: | 66.2 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MSEKKQPVDLG-LLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMET |
MSEKKQPVDL..L..........P.EDWA.LDED.DA.VWED.WD.D...DDFS.QL.AELEKHGYK.ET | |
Retrocopy | MSEKKQPVDLN>LXXXXXXXXXLPVEDWAALDEDGDAPVWEDHWDEDSADDDFSSQLGAELEKHGYKIET |
Parental | S |
S | |
Retrocopy | S |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002179 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000010402 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000019778 | 1 retrocopy |
retro_etel_961 ,
|
Felis catus | ENSFCAG00000023254 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000014208 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000026246 | 3 retrocopies |