RetrogeneDB ID: | retro_fcat_1061 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | B4:100697135..100697378(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSFCAG00000024386 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 60.49 % |
Parental protein coverage: | 71.05 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | SCGSAEYPGEAIPHHPGLPKADPGHWWASFFFGKSTLPFMATVLESPERSESPQASSGSIACDLALETMR |
S.GSAEYPGEAIP..PG....D.GH.W.SFF..KST.PF...VLE..E..ESP.A......CDLA.ETMR | |
Retrocopy | SYGSAEYPGEAIPCCPGILEVDLGH*WESFFIRKSTFPFRDIVLEASEYLESPPAFRRMFICDLAYETMR |
Parental | KQPGGQPGKAN |
KQ.GG.P.K.N | |
Retrocopy | KQLGGHPSKVN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 11 .71 RPM |
SRP017611_kidney | 0 .00 RPM | 102 .23 RPM |
SRP017611_liver | 0 .00 RPM | 59 .24 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000031800 | 7 retrocopies | |
Equus caballus | ENSECAG00000009413 | 1 retrocopy | |
Felis catus | ENSFCAG00000024386 | 14 retrocopies | |
Homo sapiens | ENSG00000125534 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000002835 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000026496 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000006064 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000016871 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000008301 | 12 retrocopies | |
Mus musculus | ENSMUSG00000016344 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000010068 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000008810 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000013739 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012722 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000018338 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000007808 | 1 retrocopy |