RetrogeneDB ID: | retro_fcat_1939 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | X:97028630..97028839(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMEM218 | ||
Ensembl ID: | ENSFCAG00000015332 | ||
Aliases: | None | ||
Description: | transmembrane protein 218 [Source:HGNC Symbol;Acc:27344] |
Percent Identity: | 61.97 % |
Parental protein coverage: | 60.87 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | CVLLSRASGVARFSVIFVFLGALIITSVLLVFPR-ASEVPAPEVEMKIVDSFFIGRYVLLAFLTAVFLGG |
C.LLSRAS.VARF.V....LGA.II.SVL..FP..A....A..VE.K.VD..FIG..V.LA.LTAVFLGG | |
Retrocopy | CGLLSRASAVARFPVMYLLLGAPIISSVLPLFPE<AGQASAAGVETKAVDASFIGCCVPLALLTAVFLGG |
Parental | L |
L | |
Retrocopy | L |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 4 .94 RPM |
SRP017611_kidney | 0 .00 RPM | 6 .60 RPM |
SRP017611_liver | 0 .00 RPM | 1 .01 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Echinops telfairi | ENSETEG00000012586 | 1 retrocopy | |
Felis catus | ENSFCAG00000015332 | 1 retrocopy |
retro_fcat_1939 ,
|