RetrogeneDB ID: | retro_ggor_1323 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 17:4962586..4963000(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP6V0C | ||
Ensembl ID: | ENSGGOG00000028600 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72.54 % |
Parental protein coverage: | 90.97 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELI-MKSIIPVVMAGIIAIYG |
.......PEYA..F...GA.A.MV.S.LGAA.G.AK.GTGI.AMSVM.PELI.MKSIIPVVMAGII.IYG | |
Retrocopy | LTDMSNSPEYALVFTISGAMATMVSSGLGAACGMAKNGTGIVAMSVMWPELIHMKSIIPVVMAGIITIYG |
Parental | LVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAE |
LV.AV..ANSL.DD.SLY.SFLQLGAGLS....GLAAGFAI.IVGD.G..GTAQQP.LFVGMILILIFA. | |
Retrocopy | LVAAVPPANSLSDDNSLYSSFLQLGAGLS----GLAAGFAIVIVGDTGKCGTAQQP*LFVGMILILIFAK |
Parental | VL |
VL | |
Retrocopy | VL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 376 .44 RPM |
SRP007412_cerebellum | 0 .35 RPM | 263 .10 RPM |
SRP007412_heart | 0 .09 RPM | 56 .66 RPM |
SRP007412_kidney | 0 .04 RPM | 138 .16 RPM |
SRP007412_liver | 0 .11 RPM | 45 .26 RPM |
SRP007412_testis | 0 .00 RPM | 42 .99 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1798 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000026428 | 1 retrocopy | |
Homo sapiens | ENSG00000185883 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000028600 | 2 retrocopies |
retro_ggor_1323 , retro_ggor_2335,
|
Macropus eugenii | ENSMEUG00000004597 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000026715 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000015439 | 5 retrocopies | |
Mus musculus | ENSMUSG00000024121 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000009416 | 2 retrocopies | |
Procavia capensis | ENSPCAG00000015060 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000007653 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000006542 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000014251 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000013420 | 3 retrocopies | |
Drosophila melanogaster | FBgn0262736 | 3 retrocopies | |
Caenorhabditis elegans | R10E11.2 | 2 retrocopies |