RetrogeneDB ID: | retro_ggor_688 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 11:434383..434611(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSGGOG00000023636 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 56.58 % |
Parental protein coverage: | 83.52 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 0 |
Parental | PVILALWEAEVGRSPEVRSSRPAWPTWQNSISTKNTKISQVSLNCGWDKLLRRLRYENRLNLGDGGCSEP |
PVI.ALWEA..G.S.EVRS..PA..TW.N..STKN.K............LL..L..ENRLN.G.G.CSEP | |
Retrocopy | PVIPALWEAKAGGSLEVRSL*PA*LTW*NPNSTKNMKLAGRGGTHL*SQLLEGLKQENRLNPGGGSCSEP |
Parental | RSCHCT |
R.CHCT | |
Retrocopy | RLCHCT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .04 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .04 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000034129 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000023636 | 1 retrocopy |
retro_ggor_688 ,
|
Gorilla gorilla | ENSGGOG00000027169 | 1 retrocopy |