RetrogeneDB ID: | retro_itri_1449 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393492.1:2776879..2777122(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSSTOG00000019436 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HN1 | ||
Ensembl ID: | ENSSTOG00000015171 | ||
Aliases: | None | ||
Description: | hematological and neurological expressed 1 [Source:HGNC Symbol;Acc:14569] |
Percent Identity: | 76.54 % |
Parental protein coverage: | 51.95 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MTTTTTFKGVDPNSRNSSRVLRPP-GGGSNFSLGFDEPTEQPVRKNKMASSIFGTPEENPPSWAKSAGAK |
MT.T.TFKG.DP..RNSS..L.PP..GGSNFSLGFDEPTE...RKNKMASSIFGTPEENPPSWAK...AK | |
Retrocopy | MTNTNTFKGFDPKIRNSSWILQPPWAGGSNFSLGFDEPTESSMRKNKMASSIFGTPEENPPSWAKLTDAK |
Parental | SSGGREDLESS |
.SGG..DLESS | |
Retrocopy | DSGGSKDLESS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000014553 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000013294 | 1 retrocopy | |
Homo sapiens | ENSG00000189159 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013996 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000013971 | 1 retrocopy | |
Mus musculus | ENSMUSG00000020737 | 6 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000610 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000002950 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000010887 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000024246 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000003661 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000015171 | 1 retrocopy |
retro_itri_1449 ,
|