RetrogeneDB ID: | retro_itri_253 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393281.1:37864562..37864767(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SHFM1 | ||
Ensembl ID: | ENSSTOG00000011501 | ||
Aliases: | None | ||
Description: | split hand/foot malformation (ectrodactyly) type 1 [Source:HGNC Symbol;Acc:10845] |
Percent Identity: | 62.5 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MSEKKQPV-DLGLLEEDDEFEEFPAEDW-AGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKME |
MSEKK.PV..LGLLEED..F..FPA.DW.AG.D..EDA.V.ED...DDNVEDDF..Q.....EK..Y.ME | |
Retrocopy | MSEKKLPV<SLGLLEED-KFKQFPAQDW<AGFDKNEDASVLEDH*NDDNVEDDFADQSQDGHEKYSYNME |
Parental | TS |
TS | |
Retrocopy | TS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010434 | 1 retrocopy | |
Equus caballus | ENSECAG00000018179 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000002237 | 2 retrocopies | |
Felis catus | ENSFCAG00000023254 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000014208 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000026246 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000015337 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000011501 | 1 retrocopy |
retro_itri_253 ,
|
Tupaia belangeri | ENSTBEG00000016474 | 3 retrocopies |