RetrogeneDB ID: | retro_mdom_1320 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 4:5134193..5134618(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000018653 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 84.62 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MAAGGSDPRAGDVEEDASQLVFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMK-TLNYTA |
M.AGG.DP.AGDVEED.SQ.VFPKEFETAETLLNS.VHMLLEH.KQ.NESA.DEQE.SEVF.K.TLNYT. | |
Retrocopy | MVAGGRDP*AGDVEEDVSQPVFPKEFETAETLLNSDVHMLLEHQKQENESAKDEQEVSEVFRK<TLNYTT |
Parental | RFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEEAKALIPSLEGRFEDEELQQILDDIQTKRS |
.FS.FKNRETIASVR.LLLQKK.HKFEL.CL..LCPET.EEAKALIPSLEGRFEDEELQQILDDIQ.KRS | |
Retrocopy | CFSHFKNRETIASVRILLLQKKCHKFELDCLVKLCPETTEEAKALIPSLEGRFEDEELQQILDDIQIKRS |
Parental | FQY |
FQY | |
Retrocopy | FQY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011746 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000004311 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000013850 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000008527 | 1 retrocopy | |
Felis catus | ENSFCAG00000027816 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004723 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000001989 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000018653 | 4 retrocopies | |
Mustela putorius furo | ENSMPUG00000016685 | 1 retrocopy | |
Mus musculus | ENSMUSG00000024258 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000021449 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000005327 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000012759 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000012436 | 1 retrocopy | |
Sorex araneus | ENSSARG00000009037 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000014817 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000023329 | 3 retrocopies |