RetrogeneDB ID: | retro_meug_1932 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | Scaffold73102:5337..5562(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UQCRH | ||
Ensembl ID: | ENSMEUG00000006850 | ||
Aliases: | None | ||
Description: | ubiquinol-cytochrome c reductase hinge protein [Source:HGNC Symbol;Acc:12590] |
Percent Identity: | 69.74 % |
Parental protein coverage: | 93.59 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | SDNKALDDGDPKKEDEEE--ELVDPLTTVREYCEQIEKCVKARERLETCTDRVSRS-NTEEDCTEELFDF |
S..K.LD.GDPKK.DE.E..ELVDPL.T.R.YCEQ.EKCV.A.ERLE.CTD.VS....TEEDCT.ELFDF | |
Retrocopy | SNKKVLDSGDPKKDDEKEKQELVDPLITMRKYCEQREKCVNAQERLEMCTDHVSSHLHTEEDCT-ELFDF |
Parental | LHARDH |
LHA..H | |
Retrocopy | LHAHNH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000009603 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000021126 | 5 retrocopies | |
Homo sapiens | ENSG00000173660 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000010631 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000006850 | 1 retrocopy |
retro_meug_1932 ,
|
Mus musculus | ENSMUSG00000063882 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000016523 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000007600 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000001134 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000016059 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025831 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000000691 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000012550 | 1 retrocopy | |
Sorex araneus | ENSSARG00000006763 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000011608 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000006572 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000006326 | 1 retrocopy |