RetrogeneDB ID: | retro_meug_286 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | GeneScaffold_9412:14117..14327(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LIN52 | ||
Ensembl ID: | ENSMEUG00000007891 | ||
Aliases: | None | ||
Description: | lin-52 homolog (C. elegans) [Source:HGNC Symbol;Acc:19856] |
Percent Identity: | 74.29 % |
Parental protein coverage: | 60.34 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MGRKMASPTDGTDLEASLLSFEKLDRASPDLWPEQXXXXXXXXXXXXXPITSSPPKWMAELEHDDIDMLK |
MG.KMASPTDGT.LEA.LLSFEKLD.ASPDLWPEQ.............PITSSPPKWMA.LEHDDIDMLK | |
Retrocopy | MGWKMASPTDGTNLEALLLSFEKLDQASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAKLEHDDIDMLK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Loxodonta africana | ENSLAFG00000002534 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000007891 | 1 retrocopy |
retro_meug_286 ,
|
Mus musculus | ENSMUSG00000085793 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017491 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000003009 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008100 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005405 | 1 retrocopy |