RetrogeneDB ID: | retro_mputfur_1226 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
Coordinates: | GL897046.1:2836869..2837109(+) | ||
Located in intron of: | ENSMPUG00000004088 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP6V0E2 | ||
Ensembl ID: | ENSMPUG00000007307 | ||
Aliases: | None | ||
Description: | ATPase, H+ transporting V0 subunit e2 [Source:HGNC Symbol;Acc:21723] |
Percent Identity: | 65. % |
Parental protein coverage: | 98.77 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLITILAQLNPLFGPQLKN |
M.......P.I....FWG..G...PWF.PKGPNRGVI.TMLV...VCC.LFWLI.ILAQLNPLFGPQLKN | |
Retrocopy | MVYNGLTVPLIVMSVFWGFVGFCVPWFIPKGPNRGVITTMLVTCSVCCSLFWLIAILAQLNPLFGPQLKN |
Parental | ETIWYVRFLW |
ETIWY....W | |
Retrocopy | ETIWYLKYQW |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Loxodonta africana | ENSLAFG00000006800 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000007307 | 2 retrocopies |
retro_mputfur_1226 , retro_mputfur_1441,
|