RetrogeneDB ID: | retro_mputfur_1552 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
Coordinates: | GL897238.1:171775..172000(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMPUG00000010789 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 50.67 % |
Parental protein coverage: | 73. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | NTTPGEVGTRQDLLKALSGDVSGLRRREARKVALGGGQHSRS--FEDEHLRGSECQGTAGVKGFYLFIGE |
NTT.GEVGTRQDLLKALS..VSGLRRR.ARK.ALGGG..............G..C.G...........G. | |
Retrocopy | NTTAGEVGTRQDLLKALSSEVSGLRRRGARKFALGGGGYPQAGFLNSRKRSGGSCTGRELXXXXXXSYGA |
Parental | RAGAG |
..G.G | |
Retrocopy | KVGHG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Mustela putorius furo | ENSMPUG00000010789 | 3 retrocopies |
retro_mputfur_1520, retro_mputfur_1552 , retro_mputfur_1569,
|