RetrogeneDB ID: | retro_ocun_1455 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 8:79088543..79088756(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FKBP1B | ||
Ensembl ID: | ENSOCUG00000008793 | ||
Aliases: | FKBP1B, FKBP12.6 | ||
Description: | FK506 binding protein 1B, 12.6 kDa (FKBP1B), mRNA [Source:RefSeq mRNA;Acc:NM_001082145] |
Percent Identity: | 56.34 % |
Parental protein coverage: | 69.61 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATG |
K..QTCVVH.T..L.N.KKF.SS.D.NK.FK....KQ..I...EE...Q.S..Q.AKLT.TP..AYG.TG | |
Retrocopy | KHSQTCVVH*TSILKNTKKFNSSQDGNKSFKYMLAKQVMIQSWEEELTQVSVAQPAKLTITPGYAYGTTG |
Parental | H |
H | |
Retrocopy | H |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 20 .59 RPM |
SRP017611_kidney | 0 .00 RPM | 1 .62 RPM |
SRP017611_liver | 0 .00 RPM | 3 .39 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Gorilla gorilla | ENSGGOG00000007752 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000008793 | 6 retrocopies |