RetrogeneDB ID: | retro_pabe_2851 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 6:30666300..30666526(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000009141 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 67.11 % |
Parental protein coverage: | 91.46 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | LYSLLQAALLCVNAIAV-LHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSI |
LYSLL...LLC..A.A..L.EE.FLKNI.WGTDQ.IGGF.EEPGI.SQL..L..SVR....V.LI..NSI | |
Retrocopy | LYSLL*TPLLCISALAI>LPEEHFLKNINWGTDQRIGGF*EEPGIRSQLIKLTQSVRNRTTVLLITANSI |
Parental | AIVLLL |
AIVLLL | |
Retrocopy | AIVLLL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .64 RPM |
SRP007412_cerebellum | 0 .00 RPM | 13 .62 RPM |
SRP007412_heart | 0 .00 RPM | 7 .62 RPM |
SRP007412_kidney | 0 .00 RPM | 20 .48 RPM |
SRP007412_liver | 0 .00 RPM | 9 .61 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000032961 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
Homo sapiens | ENSG00000134049 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy | |
Mus musculus | ENSMUSG00000090000 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009141 | 3 retrocopies |
retro_pabe_2850, retro_pabe_2851 , retro_pabe_962,
|
Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |