RetrogeneDB ID: | retro_pabe_830 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 12:32899049..32899323(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPLP2 | ||
Ensembl ID: | ENSPPYG00000002885 | ||
Aliases: | None | ||
Description: | ribosomal protein, large, P2 [Source:HGNC Symbol;Acc:10377] |
Percent Identity: | 64.89 % |
Parental protein coverage: | 80. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | SYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKL-ASVPAGGAVAVS |
SYLLAALGGN..PS.KDIKKIL......A......K.ISELNGKNI..VIAQGIGKL.ASV....AVA.S | |
Retrocopy | SYLLAALGGNPLPSTKDIKKILYNISNKANGNQCSKIISELNGKNIKGVIAQGIGKL<ASVLSHRAVAAS |
Parental | AA-PGSAAPAAGSAPAAVEEKKDE |
AA.PGS.APAAG.AP...E.K..E | |
Retrocopy | AA<PGSVAPAAGPAPTTKEKKREE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 54 .30 RPM |
SRP007412_cerebellum | 0 .00 RPM | 26 .51 RPM |
SRP007412_heart | 0 .00 RPM | 33 .99 RPM |
SRP007412_kidney | 0 .00 RPM | 98 .84 RPM |
SRP007412_liver | 0 .00 RPM | 85 .23 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000001777 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000009523 | 1 retrocopy | |
Ciona intestinalis | ENSCING00000000626 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000016458 | 3 retrocopies | |
Felis catus | ENSFCAG00000008417 | 1 retrocopy | |
Homo sapiens | ENSG00000177600 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000010789 | 5 retrocopies | |
Mus musculus | ENSMUSG00000025508 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026860 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000016296 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000002885 | 6 retrocopies |
retro_pabe_1537, retro_pabe_1543, retro_pabe_2789, retro_pabe_2844, retro_pabe_732, retro_pabe_830 ,
|
Pan troglodytes | ENSPTRG00000003137 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000002116 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000001056 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012842 | 1 retrocopy |