RetrogeneDB ID: | retro_rnor_1198 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 16:67288263..67288572(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Nme1 | ||
Ensembl ID: | ENSRNOG00000002693 | ||
Aliases: | None | ||
Description: | Nucleoside diphosphate kinase A [Source:UniProtKB/Swiss-Prot;Acc:Q05982] |
Percent Identity: | 78.64 % |
Parental protein coverage: | 67.76 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | EHYIDLKDRPFFSGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHG |
..YIDLKD.PFF.GLV.YMHSGPV.A.VWE.LNVVKTG.VML.ETNP..SKPGT..GDFCIQVGR.IIHG | |
Retrocopy | KYYIDLKDCPFFTGLVEYMHSGPVIAIVWE*LNVVKTGGVMLRETNPTGSKPGTV*GDFCIQVGRDIIHG |
Parental | SDSVESAEKEISLWFQPEELVDYKSCAQNWIYE |
..SVES..KEISLWFQPEELVDYKSCA...IYE | |
Retrocopy | GSSVESTGKEISLWFQPEELVDYKSCA*DCIYE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 67 .37 RPM |
SRP017611_kidney | 0 .00 RPM | 25 .19 RPM |
SRP017611_liver | 0 .00 RPM | 18 .36 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000004651 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000023628 | 7 retrocopies | |
Gorilla gorilla | ENSGGOG00000016526 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000028492 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000015559 | 5 retrocopies | |
Mus musculus | ENSMUSG00000091228 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000007919 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000022135 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000009415 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000002671 | 8 retrocopies | |
Rattus norvegicus | ENSRNOG00000002693 | 3 retrocopies |
retro_rnor_1198 , retro_rnor_1600, retro_rnor_704,
|
Rattus norvegicus | ENSRNOG00000049152 | 1 retrocopy |