RetrogeneDB ID: | retro_rnor_1403 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 18:61469196..61469376(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Lsm7 | ||
Ensembl ID: | ENSRNOG00000019552 | ||
Aliases: | None | ||
Description: | U6 snRNA-associated Sm-like protein LSm7 [Source:RefSeq peptide;Acc:NP_001102202] |
Percent Identity: | 65. % |
Parental protein coverage: | 58.25 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | ILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQL |
ILDLSKYIDKTI..KF....E..GIL..FDPL.NL.LDGT.E...DP.DQYKL.E.T.Q. | |
Retrocopy | ILDLSKYIDKTIHMKF*DDWEPRGILREFDPLSNLALDGTTELVQDPNDQYKLIEGTQQM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 10 .78 RPM |
SRP017611_kidney | 0 .00 RPM | 5 .58 RPM |
SRP017611_liver | 0 .00 RPM | 4 .50 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Myotis lucifugus | ENSMLUG00000013097 | 1 retrocopy | |
Mus musculus | ENSMUSG00000035215 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000000144 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000019552 | 1 retrocopy |
retro_rnor_1403 ,
|