RetrogeneDB ID: | retro_rnor_1999 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 4:181453314..181453597(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RGD1559786 | ||
Ensembl ID: | ENSRNOG00000012724 | ||
Aliases: | None | ||
Description: | UPF0587 protein C1orf123 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q498R7] |
Percent Identity: | 76.84 % |
Parental protein coverage: | 58.75 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | KCKLCARENSIEILSSTIKSYNAEDNEKFKTIVEFECRGLEPVDFQPQAGFAAEGVESGTVFSDINLQEK |
K...C.....IEILS..IKSYNA.DNEKFKT..EFEC.GLEPVDFQPQAGFAAEGVES.TVFSDIN.QEK | |
Retrocopy | KSASCVHGRTIEILSNIIKSYNAADNEKFKTVLEFECWGLEPVDFQPQAGFAAEGVESVTVFSDINPQEK |
Parental | D-WTDYDEKTQESVGIFEVTHQFVK |
..WTDYD.K.Q.SVGIFEVT.QFVK | |
Retrocopy | G>WTDYDKKAQSSVGIFEVTYQFVK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 24 .01 RPM |
SRP017611_kidney | 0 .00 RPM | 17 .72 RPM |
SRP017611_liver | 0 .00 RPM | 9 .28 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000004526 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000011509 | 1 retrocopy | |
Homo sapiens | ENSG00000162384 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004027 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000006397 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000002439 | 1 retrocopy | |
Mus musculus | ENSMUSG00000028608 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017988 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000029317 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013324 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000009003 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000001336 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000000752 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012724 | 3 retrocopies |
retro_rnor_1999 , retro_rnor_2403, retro_rnor_2705,
|