RetrogeneDB ID: | retro_rnor_2012 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 4:219503873..219504119(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Commd6 | ||
Ensembl ID: | ENSRNOG00000038012 | ||
Aliases: | Commd6, RGD1560745 | ||
Description: | COMM domain-containing protein 6 [Source:RefSeq peptide;Acc:NP_001102575] |
Percent Identity: | 82.93 % |
Parental protein coverage: | 75.93 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VLAISTLAMEGSQYREPVLDAKSEVTGQLVDFQWKLGMAVSSDSCRSLKYPYVAVLLKVADHSGQVSSKS |
V.AISTLA.E.SQ.REPVLDAKS.VTGQL.DFQWKLGMAVSSDSCRSL.YP.V.V.LKV.D.SGQVSSKS | |
Retrocopy | VFAISTLAKEESQFREPVLDAKSDVTGQLIDFQWKLGMAVSSDSCRSLRYP*VVVMLKVTDDSGQVSSKS |
Parental | IEMTIPQFQNFY |
.EMTIPQFQNF. | |
Retrocopy | MEMTIPQFQNFH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 5 .90 RPM |
SRP017611_kidney | 0 .00 RPM | 6 .56 RPM |
SRP017611_liver | 0 .00 RPM | 5 .65 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dipodomys ordii | ENSDORG00000011048 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000006061 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000010697 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000970 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026952 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000038012 | 1 retrocopy |
retro_rnor_2012 ,
|
Tursiops truncatus | ENSTTRG00000003379 | 2 retrocopies |