RetrogeneDB ID: | retro_rnor_688 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 10:48286897..48287140(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Sepw1 | ||
Ensembl ID: | ENSRNOG00000013548 | ||
Aliases: | None | ||
Description: | selenoprotein W [Source:RefSeq peptide;Acc:NP_037159] |
Percent Identity: | 86.42 % |
Parental protein coverage: | 87.1 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VYCGGRGYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLV |
VYCG...YKPKYLQ.KEK.EHE.P.CLDICGEGTPQV..FFEVTVA.KLVHS.KRGDGYVDTESKFRKLV | |
Retrocopy | VYCGA*SYKPKYLQFKEKPEHELPRCLDICGEGTPQVPRFFEVTVARKLVHSMKRGDGYVDTESKFRKLV |
Parental | TAIKAALAQCQ |
TAIKAALAQCQ | |
Retrocopy | TAIKAALAQCQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 100 .37 RPM |
SRP017611_kidney | 0 .00 RPM | 3 .14 RPM |
SRP017611_liver | 0 .00 RPM | 3 .23 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015208 | 1 retrocopy | |
Bos taurus | ENSBTAG00000008203 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000004074 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000013206 | 2 retrocopies | |
Felis catus | ENSFCAG00000015176 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000004433 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000013548 | 2 retrocopies |
retro_rnor_1819, retro_rnor_688 ,
|
Ictidomys tridecemlineatus | ENSSTOG00000001294 | 1 retrocopy |