RetrogeneDB ID: | retro_tbel_4601 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | scaffold_92640:4218..4446(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PTP4A2 | ||
Ensembl ID: | ENSTBEG00000006790 | ||
Aliases: | None | ||
Description: | protein tyrosine phosphatase type IVA, member 2 [Source:HGNC Symbol;Acc:9635] |
Percent Identity: | 94.74 % |
Parental protein coverage: | 56.3 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | EPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTN |
EPGCCVAVHCVAGLGRAPVLVALALIECGMK.EDAVQFIRQKRRG.FNSKQLLYLEKYRPKM.LRFRDTN | |
Retrocopy | EPGCCVAVHCVAGLGRAPVLVALALIECGMKCEDAVQFIRQKRRGTFNSKQLLYLEKYRPKM*LRFRDTN |
Parental | GHCCVQ |
GH.CVQ | |
Retrocopy | GHFCVQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000039121 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000006539 | 2 retrocopies | |
Homo sapiens | ENSG00000184007 | 4 retrocopies | |
Mus musculus | ENSMUSG00000028788 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000002137 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000002060 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000029603 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000001606 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000050044 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000003605 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000002775 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000006790 | 1 retrocopy |
retro_tbel_4601 ,
|
Tupaia belangeri | ENSTBEG00000009956 | 14 retrocopies | |
Tursiops truncatus | ENSTTRG00000016571 | 2 retrocopies |