RetrogeneDB ID: | retro_tbel_4617 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | scaffold_93262:2974..3190(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C4orf33 | ||
Ensembl ID: | ENSTBEG00000014766 | ||
Aliases: | None | ||
Description: | chromosome 4 open reading frame 33 [Source:HGNC Symbol;Acc:27025] |
Percent Identity: | 81.94 % |
Parental protein coverage: | 52.17 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | AFFLNDVTEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFSVSGAETKWEGKAYLPWSYFPPNVTKFN |
AFFLN.V.EQYLEVELC.HGQ.LVLLL.G.RNVWKQEL.LSF.V..AETK.EGKAYLPWSYFPPNVTKF. | |
Retrocopy | AFFLNNVSEQYLEVELCLHGQ*LVLLLYGGRNVWKQELSLSFGVHRAETK*EGKAYLPWSYFPPNVTKFS |
Parental | SF |
S. | |
Retrocopy | SW |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Mus musculus | ENSMUSG00000025766 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000010368 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000038330 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000014766 | 1 retrocopy |
retro_tbel_4617 ,
|