Detailed information on CNT0000130 (Glycine max)


BLAST search results

BLAST vs PNRD: nothing found

BLAST vs Swiss-Prot:
sp|Q9M153|GDL61_ARATH, E-value = 9e-20

BLAST vs NONCODE (A. thaliana): nothing found

Potential orthologs
: nothing found

Most similar lncRNAs
: nothing found

Expression of CNT0000130

Created with Highcharts 4.1.6Chart context menuExpression (RPKM)000.46900.5450.6842.1432.5120000000leaves (SRR924099)leaves (SRR924144)leaves (SRR926169)seed (SRR639168)shoot apical meristem (SRR824155)shoot apical meristem (SRR824156)shoot apical meristem (SRR824157)shoot apical meristem (SRR824158)shoot apical meristem (SRR824159)shoot apical meristem (SRR824160)shoot apical meristem (SRR824161)shoot apical meristem (SRR824162)shoot apical meristem (SRR824163)whole seed (SRR639162)whole seed (SRR639164)00.20.40.60.811.21.41.61.822.22.42.62.8

Peptides detected in this lncRNA

>peptide 1 (36 aa)
KGPFQIYLEKGFSFQMISLFLCHAWKEHRGKMDLAH*

Sequence

>CNT0000130
GTAAAGGGCCTTTCCAAATATATCTGGAGAAGGGATTTTCGTTCCAGATGATATCCTTGTTCCTGTGTCATGCATGGAAAGAACATAGAGGGAAAATGGA
CTTAGCCCACTGACAGAGAAGGAAGTTGTGGGCGGAATCACAGTGGAGGCTGAAGACGCAAAGTTAGCCCCATGAGTATAGTCTGATCCAATTGATTGCA
GATATGGGCTCAAATATGGCAATCCAAGACCCTGAGCTGCATGTTCAACACCAAAATACC

lncRNA-RNA interactions

Number of interactions: 4

Potential function Interacting transcript Gene description Transcript biotype lncRNA id Alignment score (LAST) Alignment length Transcript region involved in interaction Genomic orientation of interacting RNAs
GLYMA07G06640.1 Uncharacterized protein protein coding CNT0000130 483 178 CDS Trans
GLYMA07G06640.2 Uncharacterized protein protein coding CNT0000130 483 178 CDS Trans
GLYMA16G03210.1 Uncharacterized protein protein coding CNT0000130 242 86 CDS Cis
GLYMA16G03210.1 Uncharacterized protein protein coding CNT0000130 520 180 CDS Cis