Detailed information on CNT0000223 (Glycine max)


BLAST search results

BLAST vs PNRD: nothing found

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE (A. thaliana): nothing found

Potential orthologs
: nothing found

Most similar lncRNAs
: nothing found

Expression of CNT0000223

Nothing found.

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MRAKKNNQQSHLLVGAQFHIFFRSISYINIFYR*

Sequence

>CNT0000223
TAGGCTTCATATGTAGGACTTTGCCTTGTTTCCCTGCATGTATATATTGAGTGCAATATTATGAGAGCAAAGAAGAATAATCAGCAATCCCATTTGTTAG
TAGGAGCACAATTTCATATATTCTTTCGCTCAATTTCATATATCAATATTTTCTACCGGTAGGGGTCATGATGCAGCACACGAGTTCCAGATATCCGTGT
GGCTTCTCTCTCTCTCTCCCTTTCAATCTGAGAAGCCTTCCTT

lncRNA-RNA interactions

Number of interactions: 2

Potential function Interacting transcript Gene description Transcript biotype lncRNA id Alignment score (LAST) Alignment length Transcript region involved in interaction Genomic orientation of interacting RNAs
GLYMA01G39280.1 Uncharacterized protein protein coding CNT0000223 433 254 CDS Trans
GLYMA11G05990.1 Uncharacterized protein protein coding CNT0000223 678 243 CDS Cis