Detailed information on CNT0000596 (Glycine max)


BLAST search results

BLAST vs PNRD: nothing found

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE (A. thaliana): nothing found

Potential orthologs
: nothing found

Most similar lncRNAs
: nothing found

Expression of CNT0000596

Created with Highcharts 4.1.6Chart context menuExpression (RPKM)00001.70700.55900.5841.8691.5253.3324.3163.2742.647leaves (SRR924099)leaves (SRR924144)leaves (SRR926169)seed (SRR639168)shoot apical meristem (SRR824155)shoot apical meristem (SRR824156)shoot apical meristem (SRR824157)shoot apical meristem (SRR824158)shoot apical meristem (SRR824159)shoot apical meristem (SRR824160)shoot apical meristem (SRR824161)shoot apical meristem (SRR824162)shoot apical meristem (SRR824163)whole seed (SRR639162)whole seed (SRR639164)00.250.50.7511.251.51.7522.252.52.7533.253.53.7544.254.54.75

Peptides detected in this lncRNA

>peptide 1 (56 aa)
AEEGINRSPFLTALFTKTGRALGVDKILTANHRKHNGDDNSNNEIKESSYIYILFH*

Sequence

>CNT0000596
ACGCGGAAGAAGGAATTAATCGTTCCCCTTTTCTCACAGCACTGTTTACTAAAACAGGTCGGGCTTTGGGGGTAGACAAAATTCTGACAGCAAATCACAG
AAAACACAATGGTGATGACAATAGCAATAATGAGATAAAAGAAAGTAGCTATATTTACATACTTTTCCACTAGCTGCAAAACCAAATCCCTGGATTGGGG
GTTACCACTTTTGCCAATAACTATGGGTAGGAGATTCCGTGCCCAAGCA

lncRNA-RNA interactions

Number of interactions: 4

Potential function Interacting transcript Gene description Transcript biotype lncRNA id Alignment score (LAST) Alignment length Transcript region involved in interaction Genomic orientation of interacting RNAs
GLYMA05G27090.1 Uncharacterized protein protein coding CNT0000596 704 249 CDS Cis
GLYMA05G27090.2 Uncharacterized protein protein coding CNT0000596 704 249 CDS Cis
GLYMA08G10070.1 Uncharacterized protein protein coding CNT0000596 486 263 CDS Trans
GLYMA08G10070.2 Uncharacterized protein protein coding CNT0000596 486 263 CDS Trans