Detailed information on CNT0001612 (Glycine max)


BLAST search results

BLAST vs PNRD: nothing found

BLAST vs Swiss-Prot:
sp|Q6P7B0|SYWC_RAT, E-value = 6e-06

BLAST vs NONCODE (A. thaliana): nothing found

Potential orthologs: nothing found

Most similar lncRNAs: nothing found

Expression of CNT0001612

Created with Highcharts 4.1.6Chart context menuExpression (RPKM)000001.390.5441.020000000leaves (SRR924099)leaves (SRR924144)leaves (SRR926169)seed (SRR639168)shoot apical meristem (SRR824155)shoot apical meristem (SRR824156)shoot apical meristem (SRR824157)shoot apical meristem (SRR824158)shoot apical meristem (SRR824159)shoot apical meristem (SRR824160)shoot apical meristem (SRR824161)shoot apical meristem (SRR824162)shoot apical meristem (SRR824163)whole seed (SRR639162)whole seed (SRR639164)00.10.20.30.40.50.60.70.80.911.11.21.31.41.5

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MFTHLQHVNCTIHQNKAIRSSLPQDLLLIAYVSL*

>peptide 2 (35 aa)
MFLYRILPTRKRMFVYLQRAAHTVGENNQVEVGKSK

Sequence

>CNT0001612
CTTCTTCATTCTATCAATTCAGGTTTTAGGAGAGGAAAACATTGAGTGAATGTTACATGTTCACACATCTGCAACATGTAAACTGTACTATACATCAAAA
TAAAGCAATAAGAAGTTCATTACCTCAAGATTTGCTCCTAATTGCCTATGTTTCTCTATAGAATCTTGCCCACCAGAAAACGCATGTTTGTTTACCTGCA
GAGAGCCGCACATACAGTTGGTGAAAATAACCAAGTGGAGGTAGGAAAAAGCAAGA

lncRNA-RNA interactions

Number of interactions: 2

Potential function Interacting transcript Gene description Transcript biotype lncRNA id Alignment score (LAST) Alignment length Transcript region involved in interaction Genomic orientation of interacting RNAs
GLYMA03G25740.1 Uncharacterized protein protein coding CNT0001612 702 256 CDS Cis
GLYMA13G11390.1 Uncharacterized protein protein coding CNT0001612 417 183 CDS Trans