Detailed information on CNT0002079 (Glycine max)


BLAST search results

BLAST vs PNRD: nothing found

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE (A. thaliana): nothing found

Potential orthologs
: nothing found

Most similar lncRNAs
: nothing found

Expression of CNT0002079

Created with Highcharts 4.1.6Chart context menuExpression (RPKM)0000000001.2930.4690000leaves (SRR924099)leaves (SRR924144)leaves (SRR926169)seed (SRR639168)shoot apical meristem (SRR824155)shoot apical meristem (SRR824156)shoot apical meristem (SRR824157)shoot apical meristem (SRR824158)shoot apical meristem (SRR824159)shoot apical meristem (SRR824160)shoot apical meristem (SRR824161)shoot apical meristem (SRR824162)shoot apical meristem (SRR824163)whole seed (SRR639162)whole seed (SRR639164)00.10.20.30.40.50.60.70.80.911.11.21.31.4

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MLLQVIFLFPTSGPVSESFTIAFFFLSCIIDDEWGQ

Sequence

>CNT0002079
AAAATCTCCCGGTGCTTTGATATCTACAGTAACAACAAAGAATGTGCTAACTATTAGTGAGAGTATAAACTGCAGCGGTTAAGAAGTTGCAGCCTTCCAA
GTAAAAAATTTGTTAATCCATGAGTATACCATGAAGTTACAAAGGTCCTACCTTTAAAACATGTTATTACAGGTGATTTTTTTGTTCCCCACTAGTGGTC
CAGTTTCAGAATCCTTCACCATAGCCTTTTTTTTTTTATCCTGTATCATAGATGACGAGTGGGGTCAGAC

lncRNA-RNA interactions

Number of interactions: 1

Potential function Interacting transcript Gene description Transcript biotype lncRNA id Alignment score (LAST) Alignment length Transcript region involved in interaction Genomic orientation of interacting RNAs
GLYMA01G35681.1 Uncharacterized protein protein coding CNT0002079 215 149 CDS Trans