Detailed information on CNT0002638 (Glycine max)


BLAST search results

BLAST vs PNRD: nothing found

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE (A. thaliana): nothing found

Potential orthologs
: nothing found

Most similar lncRNAs
: nothing found

Expression of CNT0002638

Created with Highcharts 4.1.6Chart context menuExpression (RPKM)0000000000.47302.248000.67leaves (SRR924099)leaves (SRR924144)leaves (SRR926169)seed (SRR639168)shoot apical meristem (SRR824155)shoot apical meristem (SRR824156)shoot apical meristem (SRR824157)shoot apical meristem (SRR824158)shoot apical meristem (SRR824159)shoot apical meristem (SRR824160)shoot apical meristem (SRR824161)shoot apical meristem (SRR824162)shoot apical meristem (SRR824163)whole seed (SRR639162)whole seed (SRR639164)00.20.40.60.811.21.41.61.822.22.4

Peptides detected in this lncRNA

>peptide 1 (29 aa)
CLFIIICPCLKTISNKAASSLQNQKKGKE*

>peptide 2 (54 aa)
LPLHHHMPLFENHQQQSSKFITKPEERKRIRRGRGQGSSKVSITYPTYPSKLAS*

Sequence

>CNT0002638
CTGCCTCTTCATCATCATATGCCCCTGTTTGAAAACCATCAGCAACAAAGCAGCAAGTTCATTACAAAACCAGAAGAAAGGAAAAGAATAAGGAGGGGGA
GGGGGCAGGGTTCAAGTAAAGTGAGCATCACATATCCAACTTACCCAAGTAAACTGGCATCATAAATAAATTGTTGTCCAATCAATTCATGCACCACAAA
AAAATAGATTATGTACTTTTGTCCCAAAGATGTGCTTCATAACGAC

lncRNA-RNA interactions

Number of interactions: 5

Potential function Interacting transcript Gene description Transcript biotype lncRNA id Alignment score (LAST) Alignment length Transcript region involved in interaction Genomic orientation of interacting RNAs
GLYMA02G33090.1 Uncharacterized protein protein coding CNT0002638 598 215 CDS Cis
GLYMA03G29240.1 Uncharacterized protein protein coding CNT0002638 95 49 CDS Trans
GLYMA03G29240.2 Uncharacterized protein protein coding CNT0002638 95 49 CDS Trans
GLYMA03G29240.3 Uncharacterized protein protein coding CNT0002638 95 49 CDS Trans
GLYMA19G31960.1 Uncharacterized protein protein coding CNT0002638 97 50 CDS Trans